PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A09G0136
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 354aa    MW: 39787.6 Da    PI: 8.9176
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A09G0136genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.66.1e-1889135148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg W + Ed +l+++v+++G+ +W++Ia++++ gRt+k+c++rw+++l
      Gh_A09G0136  89 RGHWKPAEDSKLKELVTLYGPQNWNLIAEKFQ-GRTGKSCRLRWFNHL 135
                      899*****************************.*************97 PP

2Myb_DNA-binding55.61.2e-17141184146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++++T+eE+e+l  a++ +G++ W+ Iar ++ gRt++ +k++w+ 
      Gh_A09G0136 141 KKAFTEEEEERLMAAHRAYGNK-WAMIARLFP-GRTDNAVKNHWHV 184
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.55384135IPR017930Myb domain
SMARTSM007176.4E-1588137IPR001005SANT/Myb domain
PfamPF002491.8E-1689135IPR001005SANT/Myb domain
SuperFamilySSF466896.74E-2989182IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.6E-2790142IPR009057Homeodomain-like
CDDcd001672.37E-1392135No hitNo description
PROSITE profilePS5129426.515136190IPR017930Myb domain
SMARTSM007171.4E-14140188IPR001005SANT/Myb domain
PfamPF002493.7E-14141183IPR001005SANT/Myb domain
CDDcd001675.47E-11143183No hitNo description
Gene3DG3DSA:1.10.10.601.2E-21143189IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MKMTLQQFHN SSCFHHQENN GFSKYYPIYH PPSNRSMEVL KPIAGFSYCL EDHFSEGSEM  60
GAVSMSVVRG RSESFLNGKD VGVSKICSRG HWKPAEDSKL KELVTLYGPQ NWNLIAEKFQ  120
GRTGKSCRLR WFNHLDPRIN KKAFTEEEEE RLMAAHRAYG NKWAMIARLF PGRTDNAVKN  180
HWHVIMSRKY REQASAYRRR KLSQAAIGDF TDSTQSPYLA SFVGPNGSYN KGSTSRKEDE  240
INGGDLFLGS KSKSFKACEN STPLDFFSDY RSQEGLISRN SRQWKMVQEE AMLMQESCNH  300
YQPSGFSDSM ASASQVTVTE PSSSSVSHLE TTITAPSAAA SSSPPFIDFL GVGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-35891897107B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0527250.0KM052725.1 Gossypium hirsutum LOF-like transcription factor LOF1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012483585.10.0PREDICTED: myb-related protein MYBAS1-like
TrEMBLA0A0B0MR840.0A0A0B0MR84_G
STRINGPOPTR_0008s08760.12e-90(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12102896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.18e-74myb domain protein 105